Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200570_AD10.jpg Application Data

Rabbit ACO2 Polyclonal Antibody | anti-ACO2 antibody

ACO2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ACO2; ICRD; OCA8; OPA9; ACONM; HEL-S-284
Reactivity
Species Reactivity: Human (tested)
Predicted: Rat, Cow, Pig, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ACO2, Antibody; ACO2 antibody - C-terminal region; anti-ACO2 antibody
Ordering
Host
Rabbit
Reactivity
Species Reactivity: Human (tested)
Predicted: Rat, Cow, Pig, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
Sequence Length
780
Applicable Applications for anti-ACO2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACO2
Protein (#AA)
780 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

product-image-AAA200570_AD10.jpg Application Data

WB (Western Blot)

(Host: RabbitTarget Name: ACO2Sample Type: Kidney Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA200570_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: ACO2Sample Type: Kidney Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACO2Sample Tissue: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

product-image-AAA200570_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ACO2Sample Tissue: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-ACO2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of penealocytes and connective tissue (septumPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200570_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ACO2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of penealocytes and connective tissue (septumPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ACO2 antibody
This is a rabbit polyclonal antibody against ACO2. It was validated on Western Blot

Target Description: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Product Categories/Family for anti-ACO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
50
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
aconitate hydratase, mitochondrial
NCBI Official Synonym Full Names
aconitase 2
NCBI Official Symbol
ACO2
NCBI Official Synonym Symbols
ICRD; OCA8; OPA9; ACONM; HEL-S-284
NCBI Protein Information
aconitate hydratase, mitochondrial
UniProt Protein Name
Aconitate hydratase, mitochondrial
UniProt Gene Name
ACO2
UniProt Synonym Gene Names
Aconitase
UniProt Entry Name
ACON_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACO2 aco2 (Catalog #AAA200570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACO2 antibody - C-terminal region reacts with Species Reactivity: Human (tested) Predicted: Rat, Cow, Pig, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ACO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACO2 aco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYYKKHGIRW VVIGDENYGE GSSREHAALE PRHLGGRAII TKSFARIHET. It is sometimes possible for the material contained within the vial of "ACO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.