Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281730_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ACOX3 Polyclonal Antibody | anti-ACOX3 antibody

ACOX3 Rabbit pAb

Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
ACOX3, Antibody; ACOX3 Rabbit pAb; ACOX3; anti-ACOX3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP
Applicable Applications for anti-ACOX3 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281730_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using ACOX3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281730_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using ACOX3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-ACOX3 antibody
Background: Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3) is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.
Product Categories/Family for anti-ACOX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,575 Da
NCBI Official Full Name
peroxisomal acyl-coenzyme A oxidase 3 isoform b
NCBI Official Synonym Full Names
acyl-CoA oxidase 3, pristanoyl
NCBI Official Symbol
ACOX3
NCBI Protein Information
peroxisomal acyl-coenzyme A oxidase 3; BRCACox; acyl-Coenzyme A oxidase 3, pristanoyl; branched-chain acyl-CoA oxidase; pristanoyl-CoA oxidase
UniProt Protein Name
Peroxisomal acyl-coenzyme A oxidase 3
UniProt Gene Name
ACOX3
UniProt Synonym Gene Names
BRCOX; PRCOX; BRCACox
UniProt Entry Name
ACOX3_HUMAN

Similar Products

Product Notes

The ACOX3 acox3 (Catalog #AAA281730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOX3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACOX3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ACOX3 acox3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TALLPEFPRG PLDAYRARAS FSWKELALFT EGEGMLRFKK TIFSALENDP LFARSPGADL SLEKYRELNF LRCKRIFEYD FLSVEDMFKS P. It is sometimes possible for the material contained within the vial of "ACOX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.