Rabbit ACTH Polyclonal Antibody | anti-ACTH antibody
ACTH Antibody
Reactivity
Human, Monkey, Mouse, Rat
Applications
Dot Blot, Immunofluorescence, Western Blot, Immunoprecipitation, Immunohistochemistry, ELISA
Purity
Affinity Purified
Synonyms
ACTH, Antibody; ACTH Antibody; Alpha Melanocyte Stimulating Hormone; Beta Endorphin; Beta Lipotropin; Beta Melanocyte Stimulating Hormone; Beta-endorphin; CLIP; Corticotropin Like Intermediary Peptide; Met-enkephalin; MSH; NPP; Opiomelanocortin prepropeptide; POC; POMC; Tetracosactide antibody; anti-ACTH antibody
Host
Rabbit
Reactivity
Human, Monkey, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purified
Concentration
0.50-1.50 mg/ml IgG in antibody stabilization buffer (varies by lot)
Sequence Length
268
Applicable Applications for anti-ACTH antibody
CM (Confocal Microscopy), DB (Dot Blot), IF (Immunofluorescence), WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), ELISA
Immunogen
Synthetic peptide corresponding to ACTH aa 138-176.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Expression
ACTH and MSH are produced by the pituitary gland
Preparation and Storage
Store at -20°C for long term storage
Related Product Information for anti-ACTH antibody
Affinity Purified Adrenocorticotropin Hormone Antibody
Stimulates adrenal glands and release cortisol.
Stimulates adrenal glands and release cortisol.
Product Categories/Family for anti-ACTH antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
Predicted: 29 kDa
NCBI Official Full Name
proopiomelanocortin, partial
Similar Products
Product Notes
The ACTH (Catalog #AAA75627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTH Antibody reacts with Human, Monkey, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACTH can be used in a range of immunoassay formats including, but not limited to, CM (Confocal Microscopy), DB (Dot Blot), IF (Immunofluorescence), WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), ELISA. Researchers should empirically determine the suitability of the ACTH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
