Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198914_WB10.jpg WB (Western Blot) (WB Suggested Anti-ACTN2 Antibody Titration: 1.25ug/mlPositive Control: Human heart)

Rabbit ACTN2 Polyclonal Antibody | anti-ACTN2 antibody

ACTN2 antibody - C-terminal region

Gene Names
ACTN2; CMH23; CMD1AA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ACTN2, Antibody; ACTN2 antibody - C-terminal region; anti-ACTN2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
Sequence Length
894
Applicable Applications for anti-ACTN2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACTN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACTN2 Antibody Titration: 1.25ug/mlPositive Control: Human heart)

product-image-AAA198914_WB10.jpg WB (Western Blot) (WB Suggested Anti-ACTN2 Antibody Titration: 1.25ug/mlPositive Control: Human heart)

WB (Western Blot)

(Lanes:Lane1: 10 ug ACTN1-GFP transfected COS-7 lysateLane2: 10 ug ACTN2-GFP transfected COS-7 lysateLane3: 10 ug ACTN3-GFP transfected COS-7 lysateLane4: 10 ug ACTN4-GFP transfected COS-7 lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACTN2Submitted by:Johannes W. Hell, University of California)

product-image-AAA198914_WB11.jpg WB (Western Blot) (Lanes:Lane1: 10 ug ACTN1-GFP transfected COS-7 lysateLane2: 10 ug ACTN2-GFP transfected COS-7 lysateLane3: 10 ug ACTN3-GFP transfected COS-7 lysateLane4: 10 ug ACTN4-GFP transfected COS-7 lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ACTN2Submitted by:Johannes W. Hell, University of California)

WB (Western Blot)

(Host: RabbitTarget Name: ACTN2Sample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)

product-image-AAA198914_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ACTN2Sample Tissue: Human PANC1Antibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-ACTN2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198914_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ACTN2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ACTN2 antibody
This is a rabbit polyclonal antibody against ACTN2. It was validated on Western Blot and immunohistochemistry

Target Description: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Transcript variants resulting from the use of multiple poly_A sites have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
88
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
alpha-actinin-2 isoform 1
NCBI Official Synonym Full Names
actinin alpha 2
NCBI Official Symbol
ACTN2
NCBI Official Synonym Symbols
CMH23; CMD1AA
NCBI Protein Information
alpha-actinin-2
UniProt Protein Name
Alpha-actinin-2
UniProt Gene Name
ACTN2
UniProt Entry Name
ACTN2_HUMAN

Similar Products

Product Notes

The ACTN2 actn2 (Catalog #AAA198914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTN2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ACTN2 actn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIASFRILAS DKPYILAEEL RRELPPDQAQ YCIKRMPAYS GPGSVPGALD. It is sometimes possible for the material contained within the vial of "ACTN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.