Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201571_WB13.jpg WB (Western Blot) (Host: RatTarget Name: ACVR1BSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Rabbit anti-Human ACVR1B Polyclonal Antibody | anti-ACVR1B antibody

ACVR1B Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ACVR1B; ALK4; SKR2; ACTRIB; ACVRLK4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ACVR1B, Antibody; ACVR1B Antibody - middle region; anti-ACVR1B antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRT
Sequence Length
505
Applicable Applications for anti-ACVR1B antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACVR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RatTarget Name: ACVR1BSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

product-image-AAA201571_WB13.jpg WB (Western Blot) (Host: RatTarget Name: ACVR1BSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACVR1BSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA201571_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ACVR1BSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACVR1B antibody
This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-ACVR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
91
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
activin receptor type-1B isoform a
NCBI Official Synonym Full Names
activin A receptor type 1B
NCBI Official Symbol
ACVR1B
NCBI Official Synonym Symbols
ALK4; SKR2; ACTRIB; ACVRLK4
NCBI Protein Information
activin receptor type-1B
UniProt Protein Name
Activin receptor type-1B
UniProt Gene Name
ACVR1B
UniProt Synonym Gene Names
ACVRLK4; ALK4; ACTR-IB; ALK-4; SKR2
UniProt Entry Name
ACV1B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACVR1B acvr1b (Catalog #AAA201571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACVR1B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACVR1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ACVR1B acvr1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRVYHNRQRL DMEDPSCEMC LSKDKTLQDL VYDLSTSGSG SGLPLFVQRT. It is sometimes possible for the material contained within the vial of "ACVR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.