Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201235_WB13.jpg WB (Western Blot) (WB Suggested Anti-CD97 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit anti-Human ADGRE5 Polyclonal Antibody | anti-ADGRE5 antibody

ADGRE5 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ADGRE5; CD97; TM7LN1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ADGRE5, Antibody; ADGRE5 Antibody - C-terminal region; anti-ADGRE5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLC
Sequence Length
786
Applicable Applications for anti-ADGRE5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CD97 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

product-image-AAA201235_WB13.jpg WB (Western Blot) (WB Suggested Anti-CD97 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

IHC (Immunohistochemistry)

(Rabbit Anti-CD97 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intracellularPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201235_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CD97 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intracellularPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ADGRE5 antibody
This is a rabbit polyclonal antibody against CD97. It was validated on Western Blot

Target Description: This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.
Product Categories/Family for anti-ADGRE5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
976
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
CD97 antigen isoform 3 preproprotein
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E5
NCBI Official Symbol
ADGRE5
NCBI Official Synonym Symbols
CD97; TM7LN1
NCBI Protein Information
CD97 antigen
UniProt Protein Name
CD97 antigen
UniProt Gene Name
CD97
UniProt Entry Name
CD97_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADGRE5 cd97 (Catalog #AAA201235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADGRE5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADGRE5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ADGRE5 cd97 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSIFLSHNNT KELNSPILFA FSHLESSDGE AGRDPPAKDV MPGPRQELLC. It is sometimes possible for the material contained within the vial of "ADGRE5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.