Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199281_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADH4 Antibody Titration: 1.25ug/mlPositive Control: Fetal liver cell lysate)

Rabbit ADH4 Polyclonal Antibody | anti-ADH4 antibody

ADH4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ADH4; ADH-2; HEL-S-4
Reactivity
Cow, Dog, Human, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ADH4, Antibody; ADH4 antibody - middle region; anti-ADH4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
Sequence Length
380
Applicable Applications for anti-ADH4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADH4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADH4 Antibody Titration: 1.25ug/mlPositive Control: Fetal liver cell lysate)

product-image-AAA199281_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADH4 Antibody Titration: 1.25ug/mlPositive Control: Fetal liver cell lysate)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA199281_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-ADH4 antibody
This is a rabbit polyclonal antibody against ADH4. It was validated on Western Blot and immunohistochemistry

Target Description: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
127
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
alcohol dehydrogenase 4 isoform 2
NCBI Official Synonym Full Names
alcohol dehydrogenase 4 (class II), pi polypeptide
NCBI Official Symbol
ADH4
NCBI Official Synonym Symbols
ADH-2; HEL-S-4
NCBI Protein Information
alcohol dehydrogenase 4
UniProt Protein Name
Alcohol dehydrogenase 4
UniProt Gene Name
ADH4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ADH4 adh4 (Catalog #AAA199281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADH4 antibody - middle region reacts with Cow, Dog, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADH4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ADH4 adh4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSEKFVKAKA LGATDCLNPR DLHKPIQEVI IELTKGGVDF ALDCAGGSET. It is sometimes possible for the material contained within the vial of "ADH4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.