WB (Western Blot)
(WB Suggested Anti-ADORA2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Rabbit ADORA2A Polyclonal Antibody | anti-ADORA2A antibody
ADORA2A antibody - C-terminal region
Gene Names
ADORA2A; A2aR; RDC8; ADORA2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ADORA2A, Antibody; ADORA2A antibody - C-terminal region; anti-ADORA2A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP
Sequence Length
412
Applicable Applications for anti-ADORA2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 80%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2A
Protein Size (# AA)
412 amino acids
Protein Interactions
NAMPT; Actn1; Actn4; Actn3; Actn2; ADORA2A; CYTH2; DRD2; ADA;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ADORA2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226)
WB (Western Blot)
(WB Suggested Anti-ADORA2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysateADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226)
IHC (Immunohistochemistry)
(Sample type -- oral cell carcinoma Dilution -- 5ug/mL)
IHC (Immunohistochemistry)
(Sample type -- oral cell carcinoma Dilution -- 5ug/mL)
Related Product Information for anti-ADORA2A antibody
Target Description: ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.
Product Categories/Family for anti-ADORA2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
adenosine receptor A2a
NCBI Official Synonym Full Names
adenosine A2a receptor
NCBI Official Symbol
ADORA2A
NCBI Official Synonym Symbols
A2aR; RDC8; ADORA2
NCBI Protein Information
adenosine receptor A2a
UniProt Protein Name
Adenosine receptor A2a
UniProt Gene Name
ADORA2A
UniProt Synonym Gene Names
ADORA2
UniProt Entry Name
AA2AR_HUMAN
Similar Products
Product Notes
The ADORA2A adora2a (Catalog #AAA200975) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADORA2A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADORA2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ADORA2A adora2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MESQPLPGER ARSTLQKEVH AAKSLAIIVG LFALCWLPLH IINCFTFFCP. It is sometimes possible for the material contained within the vial of "ADORA2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.