Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197200_WB8.jpg WB (Western Blot) (WB Suggested Anti-AHR Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Rabbit AHR Polyclonal Antibody | anti-AHR antibody

AHR antibody - N-terminal region

Gene Names
AHR; bHLHe76
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
AHR, Antibody; AHR antibody - N-terminal region; anti-AHR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Sequence Length
848
Applicable Applications for anti-AHR antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AHR Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

product-image-AAA197200_WB8.jpg WB (Western Blot) (WB Suggested Anti-AHR Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

WB (Western Blot)

(Lanes:Lane1: 50 ug HepG2 nuclei extract + benzo[a]pyreneLane2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrenePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:AHR (Arylhydrocarbon receptor)Submitted by:Anonymous)

product-image-AAA197200_WB10.jpg WB (Western Blot) (Lanes:Lane1: 50 ug HepG2 nuclei extract + benzo[a]pyreneLane2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrenePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:AHR (Arylhydrocarbon receptor)Submitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: AHRSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197200_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: AHRSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: Human HepG2AHR antibody - N-terminal region validated by WB using Human HepG2 Lysate at 2.5ug/ml, 5ug/ml.)

product-image-AAA197200_WB13.jpg WB (Western Blot) (Sample Type: Human HepG2AHR antibody - N-terminal region validated by WB using Human HepG2 Lysate at 2.5ug/ml, 5ug/ml.)

IHC (Immunohistochemistry)

(Rabbit Anti-AHR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197200_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-AHR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-AHR antibody
This is a rabbit polyclonal antibody against AHR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
196
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
aryl hydrocarbon receptor
NCBI Official Synonym Full Names
aryl hydrocarbon receptor
NCBI Official Symbol
AHR
NCBI Official Synonym Symbols
bHLHe76
NCBI Protein Information
aryl hydrocarbon receptor
UniProt Protein Name
Aryl hydrocarbon receptor
UniProt Gene Name
AHR
UniProt Synonym Gene Names
BHLHE76; Ah receptor; AhR; bHLHe76
UniProt Entry Name
AHR_HUMAN

Similar Products

Product Notes

The AHR ahr (Catalog #AAA197200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AHR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AHR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AHR ahr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNSSSANITY ASRKRRKPVQ KTVKPIPAEG IKSNPSKRHR DRLNTELDRL. It is sometimes possible for the material contained within the vial of "AHR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.