WB (Western Blot)
(WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysate)
Rabbit AKAP10 Polyclonal Antibody | anti-AKAP10 antibody
AKAP10 antibody - middle region
Gene Names
AKAP10; PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AKAP10, Antibody; AKAP10 antibody - middle region; anti-AKAP10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
Sequence Length
662
Applicable Applications for anti-AKAP10 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKAP10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysate)
WB (Western Blot)
(WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: AKAP10Sample Type: 293TAntibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T)
WB (Western Blot)
(Host: RabbitTarget Name: AKAP10Sample Type: 293TAntibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-AKAP10 antibody
This is a rabbit polyclonal antibody against AKAP10. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.
Target Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.
Product Categories/Family for anti-AKAP10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
A-kinase anchor protein 10, mitochondrial isoform 1
NCBI Official Synonym Full Names
A-kinase anchoring protein 10
NCBI Official Symbol
AKAP10
NCBI Official Synonym Symbols
PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
NCBI Protein Information
A-kinase anchor protein 10, mitochondrial
UniProt Protein Name
A-kinase anchor protein 10, mitochondrial
UniProt Gene Name
AKAP10
UniProt Synonym Gene Names
AKAP-10; D-AKAP-2; PRKA10
UniProt Entry Name
AKA10_HUMAN
Similar Products
AKAP10 Antibody
Host: Mouse
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
AKAP10 Antibody
Host: Mouse
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
AKAP10 Antibody
Host: Mouse
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
AKAP10 Antibody
Host: Mouse
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
AKAP10 Antibody
Host: Mouse
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
Product Notes
The AKAP10 akap10 (Catalog #AAA198064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP10 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AKAP10 akap10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESLYQRTYAG KMTFGRVSDL GQFIRESEPE PDVRKSKGSM FSQAMKKWVQ. It is sometimes possible for the material contained within the vial of "AKAP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.