WB (Western Blot)
(WB Suggested Anti-ALDH1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysateALDH1A1 is supported by BioGPS gene expression data to be expressed in ACHN)
Rabbit ALDH1A1 Polyclonal Antibody | anti-ALDH1A1 antibody
ALDH1A1 antibody - middle region
Gene Names
ALDH1A1; ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ALDH1A1, Antibody; ALDH1A1 antibody - middle region; anti-ALDH1A1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG
Sequence Length
501
Applicable Applications for anti-ALDH1A1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 93%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ALDH1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysateALDH1A1 is supported by BioGPS gene expression data to be expressed in ACHN)
WB (Western Blot)
(WB Suggested Anti-ALDH1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysateALDH1A1 is supported by BioGPS gene expression data to be expressed in ACHN)
IHC (Immunohistochemistry)
(Sample Type: Human CorneaDilution: 1:200)
IHC (Immunohistochemistry)
(Sample Type: Human CorneaDilution: 1:200)
Related Product Information for anti-ALDH1A1 antibody
This is a rabbit polyclonal antibody against ALDH1A1. It was validated on Western Blot
Target Description: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.
Target Description: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.
Product Categories/Family for anti-ALDH1A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
retinal dehydrogenase 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family member A1
NCBI Official Symbol
ALDH1A1
NCBI Official Synonym Symbols
ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e
NCBI Protein Information
retinal dehydrogenase 1
UniProt Protein Name
Retinal dehydrogenase 1
UniProt Gene Name
ALDH1A1
UniProt Synonym Gene Names
ALDC; ALDH1; PUMB1; RALDH 1; RalDH1
UniProt Entry Name
AL1A1_HUMAN
Similar Products
Product Notes
The ALDH1A1 aldh1a1 (Catalog #AAA200851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH1A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH1A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ALDH1A1 aldh1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVERAKKYIL GNPLTPGVTQ GPQIDKEQYD KILDLIESGK KEGAKLECGG. It is sometimes possible for the material contained within the vial of "ALDH1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.