Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199205_WB11.jpg WB (Western Blot) (WB Suggested Anti-AMFR Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateAMFR is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit AMFR Polyclonal Antibody | anti-AMFR antibody

AMFR antibody - C-terminal region

Gene Names
AMFR; GP78; RNF45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
AMFR, Antibody; AMFR antibody - C-terminal region; anti-AMFR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
Sequence Length
643
Applicable Applications for anti-AMFR antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AMFR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AMFR Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateAMFR is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199205_WB11.jpg WB (Western Blot) (WB Suggested Anti-AMFR Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateAMFR is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: AMFRSample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199205_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: AMFRSample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: AMFRSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199205_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AMFRSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-AMFR antibody
This is a rabbit polyclonal antibody against AMFR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family (Gray et al., 2000).[supplied by OMIM].
Product Categories/Family for anti-AMFR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
267
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
AMFR protein, partial
NCBI Official Synonym Full Names
autocrine motility factor receptor
NCBI Official Symbol
AMFR
NCBI Official Synonym Symbols
GP78; RNF45
NCBI Protein Information
E3 ubiquitin-protein ligase AMFR
UniProt Protein Name
E3 ubiquitin-protein ligase AMFR
UniProt Gene Name
AMFR
UniProt Synonym Gene Names
RNF45; AMF receptor

Similar Products

Product Notes

The AMFR amfr (Catalog #AAA199205) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMFR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AMFR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AMFR amfr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGEVEVEPSE VEDFEARGSR FSKSADERQR MLVQRKDELL QQARKRFLNK. It is sometimes possible for the material contained within the vial of "AMFR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.