Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198584_WB10.jpg WB (Western Blot) (WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateANP32A is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit ANP32A Polyclonal Antibody | anti-ANP32A antibody

ANP32A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ANP32A; LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ANP32A, Antibody; ANP32A antibody - middle region; anti-ANP32A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
Sequence Length
249
Applicable Applications for anti-ANP32A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ANP32A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateANP32A is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198584_WB10.jpg WB (Western Blot) (WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateANP32A is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:ANP32ASubmitted by:Anonymous)

product-image-AAA198584_WB11.jpg WB (Western Blot) (Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:ANP32ASubmitted by:Anonymous)

IHC (Immunohiostchemistry)

(Rabbit Anti-ANP32A AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198584_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ANP32A AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-ANP32A antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198584_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ANP32A antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ANP32A antibody
This is a rabbit polyclonal antibody against ANP32A. It was validated on Western Blot and immunohistochemistry

Target Description: ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
acidic leucine-rich nuclear phosphoprotein 32 family member A
NCBI Official Synonym Full Names
acidic nuclear phosphoprotein 32 family member A
NCBI Official Symbol
ANP32A
NCBI Official Synonym Symbols
LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
NCBI Protein Information
acidic leucine-rich nuclear phosphoprotein 32 family member A
UniProt Protein Name
Acidic leucine-rich nuclear phosphoprotein 32 family member A
UniProt Gene Name
ANP32A
UniProt Synonym Gene Names
C15orf1; LANP; MAPM; PHAP1; pp32; LANP; PHAPI
UniProt Entry Name
AN32A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ANP32A anp32a (Catalog #AAA198584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANP32A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ANP32A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ANP32A anp32a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FNCEVTNLND YRENVFKLLP QLTYLDGYDR DDKEAPDSDA EGYVEGLDDE. It is sometimes possible for the material contained within the vial of "ANP32A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.