<
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
Rabbit ANXA1 Polyclonal Antibody | anti-ANXA1 antibody
ANXA1 antibody - N-terminal region
Gene Names
ANXA1; ANX1; LPC1
Reactivity
Tested:Human, MousePredicted: Cow, Dog, Guinea Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ANXA1, Antibody; ANXA1 antibody - N-terminal region; anti-ANXA1 antibody
Host
Rabbit
Reactivity
Tested:Human, Mouse
Predicted: Cow, Dog, Guinea Pig, Rat
Predicted: Cow, Dog, Guinea Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Sequence Length
346
Applicable Applications for anti-ANXA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 83%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
Protein Size (#AA)
356 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
WB (Western Blot)
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
WB (Western Blot)
(WB Suggested Anti-ANXA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-ANXA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-ANXA1 AntibodyPositive Control: Lane 1: 20ug mouse fibroblast lysatesPrimary Antibody Dilution : 1:600Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Anonymous)
WB (Western Blot)
(WB Suggested Anti-ANXA1 AntibodyPositive Control: Lane 1: 20ug mouse fibroblast lysatesPrimary Antibody Dilution : 1:600Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Anonymous)
WB (Western Blot)
(Host: RabbitTarget Name: ANXA1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)
WB (Western Blot)
(Host: RabbitTarget Name: ANXA1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)
WB (Western Blot)
(Host: RabbitTarget Name: ANXA1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ANXA1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Human Intestine)
IHC (Immunohistochemistry)
(Human Intestine)
Related Product Information for anti-ANXA1 antibody
This is a rabbit polyclonal antibody against ANXA1. It was validated on Western Blot and immunohistochemistry
Target Description: ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Target Description: ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.
Product Categories/Family for anti-ANXA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
annexin A1
NCBI Official Synonym Full Names
annexin A1
NCBI Official Symbol
ANXA1
NCBI Official Synonym Symbols
ANX1; LPC1
NCBI Protein Information
annexin A1
UniProt Protein Name
Annexin A1
UniProt Gene Name
ANXA1
UniProt Synonym Gene Names
ANX1; LPC1
UniProt Entry Name
ANXA1_HUMAN
Similar Products
Product Notes
The ANXA1 anxa1 (Catalog #AAA198085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA1 antibody - N-terminal region reacts with Tested:Human, Mouse Predicted: Cow, Dog, Guinea Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WFIENEEQEY VQTVKSSKGG PGSAVSPYPT FNPSSDVAAL HKAIMVKGVD. It is sometimes possible for the material contained within the vial of "ANXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.