Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200189_WB10.jpg WB (Western Blot) (WB Suggested Anti-AP1G1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit AP1G1 Polyclonal Antibody | anti-AP1G1 antibody

AP1G1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
AP1G1; ADTG; CLAPG1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AP1G1, Antibody; AP1G1 antibody - C-terminal region; anti-AP1G1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS
Sequence Length
822
Applicable Applications for anti-AP1G1 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AP1G1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AP1G1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

product-image-AAA200189_WB10.jpg WB (Western Blot) (WB Suggested Anti-AP1G1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: AP1G1Sample Type: JurkatAntibody Dilution: 1.0ug/mlAP1G1 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA200189_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: AP1G1Sample Type: JurkatAntibody Dilution: 1.0ug/mlAP1G1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: AP1G1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200189_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: AP1G1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: AP1G1Sample Type: HepG2Antibody Dilution: 1.0ug/mlAP1G1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200189_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AP1G1Sample Type: HepG2Antibody Dilution: 1.0ug/mlAP1G1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-AP1G1 antibody
This is a rabbit polyclonal antibody against AP1G1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
164
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
AP-1 complex subunit gamma-1 isoform b
NCBI Official Synonym Full Names
adaptor related protein complex 1 subunit gamma 1
NCBI Official Symbol
AP1G1
NCBI Official Synonym Symbols
ADTG; CLAPG1
NCBI Protein Information
AP-1 complex subunit gamma-1
UniProt Protein Name
AP-1 complex subunit gamma-1
UniProt Gene Name
AP1G1
UniProt Synonym Gene Names
ADTG; CLAPG1
UniProt Entry Name
AP1G1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AP1G1 ap1g1 (Catalog #AAA200189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AP1G1 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AP1G1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AP1G1 ap1g1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHMRSALLER MPVMEKVTTN GPTEIVQTNG ETEPAPLETK PPPSGPQPTS. It is sometimes possible for the material contained within the vial of "AP1G1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.