Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201722_WB11.jpg WB (Western Blot) (WB Suggested Anti-APBA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateAPBA1 is supported by BioGPS gene expression data to be expressed in Raji)

Rabbit anti-Human APBA1 Polyclonal Antibody | anti-APBA1 antibody

APBA1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
APBA1; X11; X11A; LIN10; MINT1; D9S411E; X11ALPHA
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
APBA1, Antibody; APBA1 antibody - N-terminal region; anti-APBA1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD
Sequence Length
837
Applicable Applications for anti-APBA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APBA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateAPBA1 is supported by BioGPS gene expression data to be expressed in Raji)

product-image-AAA201722_WB11.jpg WB (Western Blot) (WB Suggested Anti-APBA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Raji cell lysateAPBA1 is supported by BioGPS gene expression data to be expressed in Raji)

IHC (Immunohiostchemistry)

(Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :White: APBA1Gene Name :APBA1Submitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

product-image-AAA201722_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :White: APBA1Gene Name :APBA1Submitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA201722_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-APBA1 antibody
This is a rabbit polyclonal antibody against APBA1. It was validated on Western Blot and immunohistochemistry

Target Description: APBA1 is a member of the X11 protein family. It is a neuronal adaptor protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilises APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. APBA1 is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
320
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
amyloid beta (A4) protein-binding, family A, member 1 (X11), isoform CRA_b
NCBI Official Synonym Full Names
amyloid beta precursor protein binding family A member 1
NCBI Official Symbol
APBA1
NCBI Official Synonym Symbols
X11; X11A; LIN10; MINT1; D9S411E; X11ALPHA
NCBI Protein Information
amyloid-beta A4 precursor protein-binding family A member 1
UniProt Protein Name
Amyloid beta A4 precursor protein-binding family A member 1
UniProt Gene Name
APBA1
UniProt Synonym Gene Names
MINT1; X11; Mint-1
UniProt Entry Name
APBA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The APBA1 apba1 (Catalog #AAA201722) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APBA1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APBA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the APBA1 apba1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPQQQHYVGR HQRGRALEDL RAQLGQEEEE RGECLARSAS TESGFHNHTD. It is sometimes possible for the material contained within the vial of "APBA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.