Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198604_WB13.jpg WB (Western Blot) (WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysateAPOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit anti-Human, Pig APOBEC3F Polyclonal Antibody | anti-APOBEC3F antibody

APOBEC3F antibody - N-terminal region

Gene Names
APOBEC3F; A3F; KA6; ARP8; BK150C2.4.MRNA
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOBEC3F, Antibody; APOBEC3F antibody - N-terminal region; anti-APOBEC3F antibody
Ordering
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD
Sequence Length
373
Applicable Applications for anti-APOBEC3F antibody
WB (Western Blot)
Homology
Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysateAPOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA198604_WB13.jpg WB (Western Blot) (WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: OVCAR-3 cell lysateAPOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: APOBEC3FSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198604_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: APOBEC3FSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOBEC3F antibody
This is a rabbit polyclonal antibody against APOBEC3F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-APOBEC3F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3F isoform a
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3F
NCBI Official Symbol
APOBEC3F
NCBI Official Synonym Symbols
A3F; KA6; ARP8; BK150C2.4.MRNA
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3F
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3F
UniProt Gene Name
APOBEC3F
UniProt Synonym Gene Names
A3F
UniProt Entry Name
ABC3F_HUMAN

Similar Products

Product Notes

The APOBEC3F apobec3f (Catalog #AAA198604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3F antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3F can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the APOBEC3F apobec3f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKPHFRNTVE RMYRDTFSYN FYNRPILSRR NTVWLCYEVK TKGPSRPRLD. It is sometimes possible for the material contained within the vial of "APOBEC3F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.