<
WB (Western Blot)
(Human Brain and cell HomogenatesDilution : 1:1000/ 1:2000)
Rabbit anti-Human APOE Polyclonal Antibody | anti-APOE antibody
APOE antibody - N-terminal region
Gene Names
APOE; AD2; LPG; APO-E; ApoE4; LDLCQ5
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
APOE, Antibody; APOE antibody - N-terminal region; anti-APOE antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Sequence Length
317
Applicable Applications for anti-APOE antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Human Brain and cell HomogenatesDilution : 1:1000/ 1:2000)
WB (Western Blot)
(Human Brain and cell HomogenatesDilution : 1:1000/ 1:2000)
WB (Western Blot)
(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: APOESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: APOESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: APOESample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: APOESample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Sample Type: Human Fetal liverAPOE antibody - N-terminal region validated by WB using Fetal liver cell lysate at 1ug/ml.)
WB (Western Blot)
(Sample Type: Human Fetal liverAPOE antibody - N-terminal region validated by WB using Fetal liver cell lysate at 1ug/ml.)
WB (Western Blot)
(Sample Type: Mouse brainAPOE antibody - N-terminal region validated by WB using brain lysate at 1: 1,000.)
WB (Western Blot)
(Sample Type: Mouse brainAPOE antibody - N-terminal region validated by WB using brain lysate at 1: 1,000.)
IHC (Immunohistochemistry)
(Sample Type: Human Liver TissueAPOE antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Sample Type: Human Liver TissueAPOE antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Sample Type: Rat BrainAPOE antibody - N-terminal region validated by WB using Rat brain lysate at 1: 500)
IHC (Immunohistochemistry)
(Sample Type: Rat BrainAPOE antibody - N-terminal region validated by WB using Rat brain lysate at 1: 500)
IHC (Immunohistochemistry)
(Sample Type: Human kidney.Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
IHC (Immunohistochemistry)
(Sample Type: Human kidney.Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
IHC (Immunohistochemistry)
(Sample Type: Human AdrenalAnti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
IHC (Immunohistochemistry)
(Sample Type: Human AdrenalAnti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-APOE antibody
This is a rabbit polyclonal antibody against APOE. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-APOE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
apolipoprotein E isoform b
NCBI Official Synonym Full Names
apolipoprotein E
NCBI Official Symbol
APOE
NCBI Official Synonym Symbols
AD2; LPG; APO-E; ApoE4; LDLCQ5
NCBI Protein Information
apolipoprotein E
UniProt Protein Name
Apolipoprotein E
UniProt Gene Name
APOE
UniProt Synonym Gene Names
Apo-E
UniProt Entry Name
APOE_HUMAN
Similar Products
Product Notes
The APOE apoe (Catalog #AAA23552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOE antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the APOE apoe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVLWAALLVT FLAGCQAKVE QAVETEPEPE LRQQTEWQSG QRWELALGRF. It is sometimes possible for the material contained within the vial of "APOE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.