Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201476_WB11.jpg WB (Western Blot) (WB Suggested Anti-ARF6 antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit anti-Human ARF6 Polyclonal Antibody | anti-ARF6 antibody

ARF6 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ARF6, Antibody; ARF6 Antibody - C-terminal region; anti-ARF6 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Sequence Length
175
Applicable Applications for anti-ARF6 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ARF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ARF6 antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA201476_WB11.jpg WB (Western Blot) (WB Suggested Anti-ARF6 antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(Host: RabbitTarget Name: ARF6Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201476_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ARF6Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-ARF6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA201476_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ARF6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-ARF6 antibody
This is a rabbit polyclonal antibody against ARF6. It was validated on Western Blot

Target Description: This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7.
Product Categories/Family for anti-ARF6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
382
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
ADP-ribosylation factor 6
NCBI Official Synonym Full Names
ADP ribosylation factor 6
NCBI Official Symbol
ARF6
NCBI Protein Information
ADP-ribosylation factor 6
UniProt Protein Name
ADP-ribosylation factor 6
UniProt Gene Name
ARF6
UniProt Entry Name
ARF6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ARF6 arf6 (Catalog #AAA201476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARF6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARF6 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ARF6 arf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLPDAMKPHE IQEKLGLTRI RDRNWYVQPS CATSGDGLYE GLTWLTSNYK. It is sometimes possible for the material contained within the vial of "ARF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.