Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281067_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using ARHGDIA antibody. Blue: DAPI for nuclear staining.)

Rabbit ARHGDIA Polyclonal Antibody | anti-ARHGDIA antibody

ARHGDIA Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
ARHGDIA, Antibody; ARHGDIA Polyclonal Antibody; GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1; anti-ARHGDIA antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Sequence Length
204
Applicable Applications for anti-ARHGDIA antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human ARHGDIA
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using ARHGDIA antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281067_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using ARHGDIA antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ARHGDIA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281067_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ARHGDIA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-ARHGDIA antibody
This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-ARHGDIA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
396
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 18kDa; 23kDa
Observed: 26kDa
NCBI Official Full Name
rho GDP-dissociation inhibitor 1 isoform a
NCBI Official Synonym Full Names
Rho GDP dissociation inhibitor alpha
NCBI Official Symbol
ARHGDIA
NCBI Official Synonym Symbols
GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e
NCBI Protein Information
rho GDP-dissociation inhibitor 1
UniProt Protein Name
Rho GDP-dissociation inhibitor 1
UniProt Gene Name
ARHGDIA
UniProt Synonym Gene Names
GDIA1; Rho GDI 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ARHGDIA arhgdia (Catalog #AAA281067) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGDIA Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGDIA can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ARHGDIA arhgdia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEQEPTAEQ LAQIAAENEE DEHSVNYKPP AQKSIQEIQE LDKDDESLRK YKEALLGRVA VSADPNVPNV VVTGLTLVCS SAPGPLELDL TGDLESFKKQ SFVLKEGVEY RIKISFRVNR EIVSGMKYIQ HTYRKGVKID KTDYMVGSYG PRAEEYEFLT PVEEAPKGML ARGSYSIKSR FTDDDKTDHL SWEWNLTIKK DWKD. It is sometimes possible for the material contained within the vial of "ARHGDIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.