Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46825_IHC11.jpg IHC (Immunohistochemisry) (ARHGEF1 was detected in paraffin-embedded sections of rat lymphaden tissues using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit ARHGEF1 Polyclonal Antibody | anti-ARHGEF1 antibody

Anti-ARHGEF1 Antibody

Gene Names
ARHGEF1; LSC; GEF1; LBCL2; SUB1.5; P115-RHOGEF
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
ARHGEF1, Antibody; Anti-ARHGEF1 Antibody; ARHGEF 1; ARHGEF1; GEF 1; GEF1; LBCL 2; LBCL2; LSC; p115 RhoGEF; p115-RhoGEF; p115RhoGEF; Q92888; Rho guanine nucleotide exchange factor 1; anti-ARHGEF1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
912
Applicable Applications for anti-ARHGEF1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE), different from the related mouse and rat sequences by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(ARHGEF1 was detected in paraffin-embedded sections of rat lymphaden tissues using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46825_IHC11.jpg IHC (Immunohistochemisry) (ARHGEF1 was detected in paraffin-embedded sections of rat lymphaden tissues using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(ARHGEF1 was detected in paraffin-embedded sections of mouse lymphaden tissues using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46825_IHC13.jpg IHC (Immunohiostchemistry) (ARHGEF1 was detected in paraffin-embedded sections of mouse lymphaden tissues using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of ARHGEF1 expression in rat brain extract (lane 1), HELA whole cell lysates (lane 2) and JURKAT whole cell lysates (lane 3). ARHGEF1 at 120KD was detected using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46825_WB15.jpg WB (Western Blot) (Western blot analysis of ARHGEF1 expression in rat brain extract (lane 1), HELA whole cell lysates (lane 2) and JURKAT whole cell lysates (lane 3). ARHGEF1 at 120KD was detected using rabbit anti- ARHGEF1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-ARHGEF1 antibody
Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection.
Background: Rho guanine nucleotide exchange factor 1 is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
References
1. Aasheim HC, Pedeutour F, Smeland EB (May 1997). "Characterization, expression and chromosomal localization of a human gene homologous to the mouse Lsc oncogene, with strongest expression in hematopoetic tissues". Oncogene 14 (14): 1747-52.
2. Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G (Nov 1996). "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase". J Biol Chem 271 (41): 25452-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105,854 Da
NCBI Official Full Name
rho guanine nucleotide exchange factor 1 isoform 2
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 1
NCBI Official Symbol
ARHGEF1
NCBI Official Synonym Symbols
LSC; GEF1; LBCL2; SUB1.5; P115-RHOGEF
NCBI Protein Information
rho guanine nucleotide exchange factor 1
UniProt Protein Name
Rho guanine nucleotide exchange factor 1
UniProt Gene Name
ARHGEF1
UniProt Synonym Gene Names
p115-RhoGEF; p115RhoGEF

Similar Products

Product Notes

The ARHGEF1 arhgef1 (Catalog #AAA46825) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ARHGEF1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ARHGEF1 arhgef1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.