IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using ARL3 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit ARL3 Polyclonal Antibody | anti-ARL3 antibody
ARL3 Rabbit pAb
Gene Names
ARL3; ARFL3
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ARL3, Antibody; ARL3 Rabbit pAb; ARL3; ARFL3; anti-ARL3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Applicable Applications for anti-ARL3 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human ARL3 (NP_004302.1).
Cellular Location
Cell projection, Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Nucleus, Peripheral membrane protein, centrosome, cilium, cytoskeleton, microtubule organizing center, spindle
Positive Samples
A-431, LO2, HeLa, Mouse eye, Mouse brain, Mouse heart, Mouse kidney, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using ARL3 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of L929 cells using ARL3 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of C6 cells using ARL3 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of C6 cells using ARL3 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using ARL3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using ARL3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-ARL3 antibody
Background: ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
Product Categories/Family for anti-ARL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,456 Da
NCBI Official Full Name
ADP-ribosylation factor-like protein 3
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 3
NCBI Official Symbol
ARL3
NCBI Official Synonym Symbols
ARFL3
NCBI Protein Information
ADP-ribosylation factor-like protein 3; ARF-like 3
UniProt Protein Name
ADP-ribosylation factor-like protein 3
UniProt Gene Name
ARL3
UniProt Synonym Gene Names
ARFL3
UniProt Entry Name
ARL3_HUMAN
Similar Products
Product Notes
The ARL3 arl3 (Catalog #AAA281648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARL3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ARL3 arl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLLSILRKL KSAPDQEVRI LLLGLDNAGK TTLLKQLASE DISHITPTQG FNIKSVQSQG FKLNVWDIGG QRKIRPYWKN YFENTDILIY VIDSADRKRF EETGQELAEL LEEEKLSCVP VLIFANKQDL LTAAPASEIA EGLNLHTIRD RVWQIQSCSA LTGEGVQDGM NWVCKNVNAK KK. It is sometimes possible for the material contained within the vial of "ARL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.