Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224258_IHC13.jpg IHC (Immunohiostchemistry) (Arrestin B2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X)

Rabbit anti-Human, Dog Arrestin B2 Polyclonal Antibody

Arrestin B2 antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
Arrestin B2, Antibody; Arrestin B2 antibody; Polyclonal Arrestin B2; Anti-Arrestin B2; ARB2; ARR2; Arrestin Beta 2; DKFZp686L0365; anti-Arrestin B2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Dog
Clonality
Polyclonal
Specificity
Arrestin B2 antibody was raised against the middle region of ARRB2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARRB2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
409
Applicable Applications for anti-Arrestin B2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.
Cross-Reactivity
Human,Dog
Immunogen
Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Arrestin B2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X)

product-image-AAA224258_IHC13.jpg IHC (Immunohiostchemistry) (Arrestin B2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X)

WB (Western Blot)

(Western Blot showing Arrestin B2 antibody used at a concentration of 1 ug/ml against HepG2 Cell Lysate)

product-image-AAA224258_WB15.jpg WB (Western Blot) (Western Blot showing Arrestin B2 antibody used at a concentration of 1 ug/ml against HepG2 Cell Lysate)
Related Product Information for anti-Arrestin B2 antibody
Rabbit polyclonal Arrestin B2 antibody raised against the middle region of ARRB2
Product Categories/Family for anti-Arrestin B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
44 kDa (MW of target protein)
NCBI Official Full Name
arrestin, beta 2-like protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Arrestin B2 (Catalog #AAA224258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Arrestin B2 antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Arrestin B2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Arrestin B2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Arrestin B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.