Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197156_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ASCL1Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ASCL1 Polyclonal Antibody | anti-ASCL1 antibody

ASCL1 Antibody - N-terminal region

Gene Names
ASCL1; ASH1; HASH1; MASH1; bHLHa46
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
ASCL1, Antibody; ASCL1 Antibody - N-terminal region; anti-ASCL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYS
Sequence Length
236
Applicable Applications for anti-ASCL1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASCL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: ASCL1Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA197156_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ASCL1Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: ASCL1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA197156_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: ASCL1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-ASCL1 antibody
This is a rabbit polyclonal antibody against ASCL1. It was validated on Western Blot

Target Description: This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
429
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
achaete-scute homolog 1
NCBI Official Synonym Full Names
achaete-scute family bHLH transcription factor 1
NCBI Official Symbol
ASCL1
NCBI Official Synonym Symbols
ASH1; HASH1; MASH1; bHLHa46
NCBI Protein Information
achaete-scute homolog 1
UniProt Protein Name
Achaete-scute homolog 1
UniProt Gene Name
ASCL1
UniProt Synonym Gene Names
ASH1; BHLHA46ImportedManual assertion inferred from database entriesiHGNC:738; HASH11 PublicationManual assertion based on opinion iniRef.1; bHLHa46ImportedManual assertion inferred from database entriesiHGNC:738

Similar Products

Product Notes

The ASCL1 ascl1 (Catalog #AAA197156) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASCL1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ASCL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ASCL1 ascl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAPQLRPAAD GQPSGGGHKS APKQVKRQRS SSPELMRCKR RLNFSGFGYS. It is sometimes possible for the material contained within the vial of "ASCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.