Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125487_WB11.jpg WB (Western Blot) (Figure 1. Western blot analysis of ATP11C using anti-ATP11C antibody.)

Rabbit anti-Human ATP11C Polyclonal Antibody | anti-ATP11C antibody

Anti-ATP11C Antibody

Gene Names
ATP11C; ATPIG; ATPIQ; HACXL
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
ATP11C, Antibody; Anti-ATP11C Antibody; Phospholipid-transporting ATPase IG (EC:7.6.2.1); ATPase IQ; ATPase class VI type 11C; P4-ATPase flippase complex alpha subunit ATP11C; ATP11C; ATPIG, ATPIQ; anti-ATP11C antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1119
Applicable Applications for anti-ATP11C antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human ATP11C (QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Figure 1. Western blot analysis of ATP11C using anti-ATP11C antibody.)

product-image-AAA125487_WB11.jpg WB (Western Blot) (Figure 1. Western blot analysis of ATP11C using anti-ATP11C antibody.)

IF (Immunofluorescence)

product-image-AAA125487_IF13.jpg IF (Immunofluorescence)

FCM/FACS (Flow Cytometry)

product-image-AAA125487_FCM15.png FCM/FACS (Flow Cytometry)
Related Product Information for anti-ATP11C antibody
Description: Rabbit IgG polyclonal antibody for ATP11C detection. Tested with WB, ICC/IF, FCM in Human.

Background: ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.
References
1. Arashiki, N., Takakuwa, Y., Mohandas, N., Hale, J., Yoshida, K., Ogura, H., Utsugisawa, T., Ohga, S., Miyano, S., Ogawa, S., Kojima, S., Kanno, H. ATP11C is a major flippase in human erythrocytes and its defect causes congenital hemolytic anemia. Haematologica 101: 559-565, 2016.
2. Nesbit, M. A., Bowl, M. R., Harding, B., Schlessinger, D., Whyte, M. P., Thakker, R. V. X-linked hypoparathyroidism region on Xq27 is evolutionarily conserved with regions on 3q26 and 13q34 and contains a novel P-type ATPase. Genomics 84: 1060-1070, 2004.
3. Segawa, K., Kurata, S., Yanagihashi, Y., Brummelkamp, T. R., Matsuda, F., Nagata, S. Caspase-mediated cleavage of phospholipid flippase for apoptotic phosphatidylserine exposure. Science 344: 1164-1168, 2014.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phospholipid-transporting ATPase IG isoform b
NCBI Official Synonym Full Names
ATPase phospholipid transporting 11C
NCBI Official Symbol
ATP11C
NCBI Official Synonym Symbols
ATPIG; ATPIQ; HACXL
NCBI Protein Information
phospholipid-transporting ATPase IG
UniProt Protein Name
Phospholipid-transporting ATPase IG
UniProt Gene Name
ATP11C
UniProt Synonym Gene Names
ATPIG; ATPIQ
UniProt Entry Name
AT11C_HUMAN

Similar Products

Product Notes

The ATP11C atp11c (Catalog #AAA125487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATP11C Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP11C can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP11C atp11c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP11C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.