IHC (Immunohistochemisry)
(Anti- SERCA2 ATPase antibody,IHC(P)IHC(P): Rat Lung Tissue)
ATP2A2 Polyclonal Antibody | anti-ATP2A2 antibody
Anti-ATP2A2 Antibody
Gene Names
ATP2A2; DD; DAR; ATP2B; SERCA2
Reactivity
Mouse, RatPredicted to work with: Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ATP2A2, Antibody; Anti-ATP2A2 Antibody; Sarcoplasmic/endoplasmic reticulum calcium ATPase 2; AT2A2_HUMAN; ATP2A2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; Calcium pump 2; Calcium-transporting ATPase sarcoplasmic reticulum type; Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform; Cardiac Ca2+ ATPase; DAR; DD; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; MGC45367; SERCA 2; SERCA2; serca2a; slow twitch skeletal muscle isoform; SR Ca(2+)-ATPase 2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; anti-ATP2A2 antibody
Reactivity
Mouse, Rat
Predicted to work with: Human
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
997
Applicable Applications for anti-ATP2A2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A2(1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemisry)
(Anti- SERCA2 ATPase antibody,IHC(P)IHC(P): Rat Lung Tissue)
IHC (Immunohistochemisry)
(Anti- SERCA2 ATPase antibody,IHC(P)IHC(P): Rat Lung Tissue)
IHC (Immunohiostchemistry)
(Anti- SERCA2 ATPase antibody,IHC(P)IHC(P): Mouse Lung Tissue)
IHC (Immunohiostchemistry)
(Anti- SERCA2 ATPase antibody,IHC(P)IHC(P): Mouse Lung Tissue)
WB (Western Blot)
(Anti- SERCA2 ATPase antibody, Western blottingAll lanes: Anti SERCA2 ATPase at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 115KDObserved bind size: 115KD)
WB (Western Blot)
(Anti- SERCA2 ATPase antibody, Western blottingAll lanes: Anti SERCA2 ATPase at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 115KDObserved bind size: 115KD)
Related Product Information for anti-ATP2A2 antibody
Description: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
Background: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
References
1. Ahn, W., Lee, M. G., Kim, K. H., Muallem, S. Multiple effects of SERCA2b mutations associated with Darier's disease. J. Biol. Chem. 278: 20795-20801, 2003. 2. Berk, D. R., Taube, J. M., Bruckner, A. L., Lane, A. T. A sporadic patient with acrokeratosis verruciformis of Hopf and a novel ATP2A2 mutation. (Letter) Brit. J. Derm. 163: 653-654, 2010. 3. Chao, S.-C., Yang, M.-H., Lee, J. Y.-Y. Mutation analysis of the ATP2A2 gene in Taiwanese patients with Darier's disease. Brit. J. Derm. 146: 958-963, 2002.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
109,734 Da
NCBI Official Full Name
sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform a
NCBI Official Synonym Full Names
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
NCBI Official Symbol
ATP2A2
NCBI Official Synonym Symbols
DD; DAR; ATP2B; SERCA2
NCBI Protein Information
sarcoplasmic/endoplasmic reticulum calcium ATPase 2
UniProt Protein Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
UniProt Gene Name
ATP2A2
UniProt Synonym Gene Names
ATP2B; SERCA2; SR Ca(2+)-ATPase 2
UniProt Entry Name
AT2A2_HUMAN
Similar Products
Product Notes
The ATP2A2 atp2a2 (Catalog #AAA46529) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATP2A2 Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2A2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP2A2 atp2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP2A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.