Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281693_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using ATP5I antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ATP5I Polyclonal Antibody | anti-ATP5I antibody

ATP5I Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ATP5I; ATP5K
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ATP5I, Antibody; ATP5I Rabbit pAb; ATP5I; ATP5K; anti-ATP5I antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Applicable Applications for anti-ATP5I antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human ATP5I (NP_009031.1).
Cellular Location
Mitochondrion, Mitochondrion inner membrane
Positive Samples
U-87MG, LO2, 293T, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using ATP5I antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281693_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using ATP5I antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human stomach using ATP5I antibody at dilution of 1:100 (40x lens).)

product-image-AAA281693_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human stomach using ATP5I antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ATP5I antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281693_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ATP5I antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ATP5I antibody
Background: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ATP5I antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
521
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,933 Da
NCBI Official Full Name
ATP synthase subunit e, mitochondrial
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
NCBI Official Symbol
ATP5I
NCBI Official Synonym Symbols
ATP5K
NCBI Protein Information
ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase e chain, mitochondrial; F1F0-ATP synthase, murine e subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
UniProt Protein Name
ATP synthase subunit e, mitochondrial
UniProt Gene Name
ATP5I
UniProt Synonym Gene Names
ATP5K; ATPase subunit e
UniProt Entry Name
ATP5I_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ATP5I atp5i (Catalog #AAA281693) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5I Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5I can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP5I atp5i for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVPPVQVSPL IKLGRYSALF LGVAYGATRY NYLKPRAEEE RRIAAEEKKK QDELKRIARE LAEDDSILK. It is sometimes possible for the material contained within the vial of "ATP5I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.