Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281762_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

Rabbit anti-Human, Mouse B7-H3/CD276 Polyclonal Antibody | anti-B7-H3/CD276 antibody

B7-H3/CD276 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CD276; B7H3; B7-H3; B7RP-2; 4Ig-B7-H3
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
B7-H3/CD276, Antibody; B7-H3/CD276 Rabbit pAb; CD276; 4Ig-B7-H3; B7-H3; B7H3; B7RP-2; anti-B7-H3/CD276 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
LAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQG
Applicable Applications for anti-B7-H3/CD276 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human B7-H3/CD276 (NP_001019907.1).
Positive Samples
U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

product-image-AAA281762_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human tonsil using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

product-image-AAA281762_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human tonsil using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human placenta using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

product-image-AAA281762_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human placenta using B7-H3/CD276 antibody at dilution of 1:150 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of U-87MG cells, using B7-H3/CD276 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

product-image-AAA281762_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of U-87MG cells, using B7-H3/CD276 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Related Product Information for anti-B7-H3/CD276 antibody
Background: The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
57,235 Da
NCBI Official Full Name
B7-H3 protein
NCBI Official Synonym Full Names
CD276 molecule
NCBI Official Symbol
CD276
NCBI Official Synonym Symbols
B7H3; B7-H3; B7RP-2; 4Ig-B7-H3
NCBI Protein Information
CD276 antigen; B7 homolog 3; costimulatory molecule
UniProt Protein Name
CD276 antigen
UniProt Gene Name
CD276
UniProt Synonym Gene Names
B7H3; B7-H3
UniProt Entry Name
CD276_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The B7-H3/CD276 cd276 (Catalog #AAA281762) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B7-H3/CD276 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's B7-H3/CD276 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the B7-H3/CD276 cd276 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAQGNASLRL QRVRVADEGS FTCFVSIRDF GSAAVSLQVA APYSKPSMTL EPNKDLRPGD TVTITCSSYQ GYPEAEVFWQ DGQGVPLTGN VTTSQMANEQ G. It is sometimes possible for the material contained within the vial of "B7-H3/CD276, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.