Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199756_IHC13.jpg IHC (Immunohiostchemistry) (Immunofluorescent BACE1 detection in mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working Dilution: 2-10 ug/ml)

Rabbit BACE1 Polyclonal Antibody | anti-BACE1 antibody

BACE1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
BACE1; ASP2; BACE; HSPC104
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
BACE1, Antibody; BACE1 antibody - N-terminal region; anti-BACE1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Sequence Length
501
Applicable Applications for anti-BACE1 antibody
IF (Immunofluorescence), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BACE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Immunofluorescent BACE1 detection in mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working Dilution: 2-10 ug/ml)

product-image-AAA199756_IHC13.jpg IHC (Immunohiostchemistry) (Immunofluorescent BACE1 detection in mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).Working Dilution: 2-10 ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human AdrenalAnti-BACE1 antibody IHC of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA199756_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human AdrenalAnti-BACE1 antibody IHC of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-BACE1 antibody
This is a rabbit polyclonal antibody against BACE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
beta-secretase 1 isoform A preproprotein
NCBI Official Synonym Full Names
beta-secretase 1
NCBI Official Symbol
BACE1
NCBI Official Synonym Symbols
ASP2; BACE; HSPC104
NCBI Protein Information
beta-secretase 1
UniProt Protein Name
Beta-secretase 1
UniProt Gene Name
BACE1
UniProt Synonym Gene Names
BACE; KIAA1149; ASP2; Asp 2
UniProt Entry Name
BACE1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BACE1 bace1 (Catalog #AAA199756) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BACE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BACE1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BACE1 bace1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQGYYVEMTV GSPPQTLNIL VDTGSSNFAV GAAPHPFLHR YYQRQLSSTY. It is sometimes possible for the material contained within the vial of "BACE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.