Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282308_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using BCKDHA Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human BCKDHA Polyclonal Antibody | anti-BCKDHA antibody

BCKDHA Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ZNF76; ZNF523; Zfp523; D6S229E
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
BCKDHA, Antibody; BCKDHA Rabbit pAb; BCKDHA; BCKDE1A; MSU; MSUD1; OVD1A; 2-oxoisovalerate dehydrogenase subunit alpha; mitochondrial; anti-BCKDHA antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HPVAVPSESTILAVQTEVGLEDLAAEDDEGFSADAVVALEQYASKVLHDSQIPRNGKGQQVGDRAFRCGYK
Applicable Applications for anti-BCKDHA antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 276-445 of human BCKDHA (NP_000700.1).
Cellular Location
Mitochondrion matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using BCKDHA Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282308_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using BCKDHA Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using BCKDHA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA282308_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using BCKDHA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-BCKDHA antibody
The branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-BCKDHA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,831 Da
NCBI Official Full Name
zinc finger protein 76
NCBI Official Synonym Full Names
zinc finger protein 76
NCBI Official Symbol
ZNF76
NCBI Official Synonym Symbols
ZNF523; Zfp523; D6S229E
NCBI Protein Information
zinc finger protein 76; zinc finger protein 523; zinc finger protein 76 (expressed in testis)
UniProt Protein Name
Zinc finger protein 76
UniProt Gene Name
ZNF76
UniProt Synonym Gene Names
D6S229E; ZNF523
UniProt Entry Name
ZNF76_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCKDHA znf76 (Catalog #AAA282308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCKDHA Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCKDHA can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the BCKDHA znf76 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HPVAVPSEST ILAVQTEVGL EDLAAEDDEG FSADAVVALE QYASKVLHDS QIPRNGKGQQ VGDRAFRCGY K. It is sometimes possible for the material contained within the vial of "BCKDHA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.