WB (Western Blot)
(Host: RabbitTarget Name: BCL6Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit BCL6 Polyclonal Antibody | anti-BCL6 antibody
BCL6 Antibody - C-terminal region
Gene Names
BCL6; BCL5; LAZ3; BCL6A; ZNF51; ZBTB27
Reactivity
Tested Species: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCL6, Antibody; BCL6 Antibody - C-terminal region; BCL5, LAZ3, BCL6A, ZNF51, ZBTB27; anti-BCL6 antibody
Host
Rabbit
Reactivity
Tested Species: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP
Sequence Length
706
Applicable Applications for anti-BCL6 antibody
WB (Western Blot)
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human BCL6
Protein Size (# AA)
706 amino acids
Blocking Peptide
For anti-BCL6 (MBS3200593) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: BCL6Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: BCL6Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BCL6 antibody
Target Description: The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Product Categories/Family for anti-BCL6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
B-cell lymphoma 6 protein isoform 1
NCBI Official Synonym Full Names
BCL6 transcription repressor
NCBI Official Symbol
BCL6
NCBI Official Synonym Symbols
BCL5; LAZ3; BCL6A; ZNF51; ZBTB27
NCBI Protein Information
B-cell lymphoma 6 protein
UniProt Protein Name
B-cell lymphoma 6 protein
UniProt Gene Name
BCL6
UniProt Synonym Gene Names
BCL5; LAZ3; ZBTB27; ZNF51; BCL-6; BCL-5
UniProt Entry Name
BCL6_HUMAN
Similar Products
Product Notes
The BCL6 bcl6 (Catalog #AAA197228) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL6 Antibody - C-terminal region reacts with Tested Species: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BCL6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BCL6 bcl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHTGEKPYHC EKCNLHFRHK SQLRLHLRQK HGAITNTKVQ YRVSATDLPP. It is sometimes possible for the material contained within the vial of "BCL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.