Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224240_IHC13.jpg IHC (Immunohiostchemistry) (BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

Rabbit anti-Human, Dog BMP2K Polyclonal Antibody | anti-BMP2K antibody

BMP2K antibody

Average rating 0.0
No ratings yet
Gene Names
BMP2K; BIKE; HRIHFB2017
Reactivity
Human, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
BMP2K, Antibody; BMP2K antibody; Polyclonal BMP2K; Anti-BMP2K; DKFZp434K0614; BMPK-2; BMP2K; DKFZp434P0116; Bmp2 Inducible Kinase; BMPK 2; BIKE; HRIHFB2017; anti-BMP2K antibody
Ordering
Host
Rabbit
Reactivity
Human, Dog
Clonality
Polyclonal
Specificity
BMP2K antibody was raised against the C terminal of BMP2K
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BMP2K antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1161
Applicable Applications for anti-BMP2K antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.
Cross-Reactivity
Human,Dog
Immunogen
BMP2K antibody was raised using the C terminal of BMP2K corresponding to a region with amino acids  AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

product-image-AAA224240_IHC13.jpg IHC (Immunohiostchemistry) (BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)

WB (Western Blot)

(BMP2K antibody (AAA224240) used at 5 ug/ml to detect target protein.)

product-image-AAA224240_WB15.jpg WB (Western Blot) (BMP2K antibody (AAA224240) used at 5 ug/ml to detect target protein.)
Related Product Information for anti-BMP2K antibody
Rabbit polyclonal BMP2K antibody raised against the C terminal of BMP2K
Product Categories/Family for anti-BMP2K antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
74 kDa (MW of target protein)
NCBI Official Full Name
BMP-2-inducible protein kinase isoform a
NCBI Official Synonym Full Names
BMP2 inducible kinase
NCBI Official Symbol
BMP2K
NCBI Official Synonym Symbols
BIKE; HRIHFB2017
NCBI Protein Information
BMP-2-inducible protein kinase
UniProt Protein Name
BMP-2-inducible protein kinase
UniProt Gene Name
BMP2K
UniProt Synonym Gene Names
BIKE; BIKe
UniProt Entry Name
BMP2K_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BMP2K bmp2k (Catalog #AAA224240) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP2K antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's BMP2K can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BMP2K bmp2k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP2K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.