Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281710_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NCI-H460 cells using Brachyury Rabbit pAb aBrachyury diluBrachyuryion of 1:200 (40x lens). Blue: DAPI for nuclear sBrachyuryaining.)

Rabbit anti-Human, Rat Brachyury Polyclonal Antibody | anti-T antibody

Brachyury Rabbit pAb

Gene Names
T; TFT; SAVA
Reactivity
Human, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Brachyury, Antibody; Brachyury Rabbit pAb; T; SAVA; TFT; anti-T antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
HKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM
Applicable Applications for anti-T antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
RecombinanBrachyury fusion proBrachyuryein conBrachyuryaining a sequence corresponding Brachyuryo amino acids 226-435 of human Brachyury (NP_003172.1).
Cellular Location
Nucleus
Positive Samples
H460
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NCI-H460 cells using Brachyury Rabbit pAb aBrachyury diluBrachyuryion of 1:200 (40x lens). Blue: DAPI for nuclear sBrachyuryaining.)

product-image-AAA281710_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NCI-H460 cells using Brachyury Rabbit pAb aBrachyury diluBrachyuryion of 1:200 (40x lens). Blue: DAPI for nuclear sBrachyuryaining.)

WB (Western Blot)

(Western blot analysis of exBrachyuryracBrachyurys of H460 cells, using Brachyury Rabbit pAb aBrachyury 1:1000 diluBrachyuryion.Secondary anBrachyuryibody: HRP GoaBrachyury AnBrachyuryi-RabbiBrachyury IgG (H+L) (AS014) aBrachyury 1:10000 diluBrachyuryion.LysaBrachyuryes/proBrachyuryeins: 25ug per lane.Blocking buffer: 3% nonfaBrachyury dry milk in BrachyuryBSBrachyury.DeBrachyuryecBrachyuryion: ECL Basic KiBrachyury (RM00020).Exposure Brachyuryime: 30s.)

product-image-AAA281710_WB15.jpg WB (Western Blot) (Western blot analysis of exBrachyuryracBrachyurys of H460 cells, using Brachyury Rabbit pAb aBrachyury 1:1000 diluBrachyuryion.Secondary anBrachyuryibody: HRP GoaBrachyury AnBrachyuryi-RabbiBrachyury IgG (H+L) (AS014) aBrachyury 1:10000 diluBrachyuryion.LysaBrachyuryes/proBrachyuryeins: 25ug per lane.Blocking buffer: 3% nonfaBrachyury dry milk in BrachyuryBSBrachyury.DeBrachyuryecBrachyuryion: ECL Basic KiBrachyury (RM00020).Exposure Brachyuryime: 30s.)
Related Product Information for anti-T antibody
Background: The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,078 Da
NCBI Official Full Name
brachyury protein isoform 2
NCBI Official Synonym Full Names
T brachyury transcription factor
NCBI Official Symbol
T
NCBI Official Synonym Symbols
TFT; SAVA
NCBI Protein Information
brachyury protein; T brachyury homolog; T, brachyury homolog; protein T
UniProt Protein Name
Brachyury protein
UniProt Gene Name
T
UniProt Entry Name
BRAC_HUMAN

Similar Products

Product Notes

The T t (Catalog #AAA281710) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Brachyury Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Brachyury can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the T t for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKEMMEEPGD SQQPGYSQWG WLLPGTSTLC PPANPHPQFG GALSLPSTHS CDRYPTLRSH RSSPYPSPYA HRNNSPTYSD NSPACLSMLQ SHDNWSSLGM PAHPSMLPVS HNASPPTSSS QYPSLWSVSN GAVTPGSQAA AVSNGLGAQF FRGSPAHYTP LTHPVSAPSS SGSPLYEGAA AATDIVDSQY DAAAQGRLIA SWTPVSPPSM. It is sometimes possible for the material contained within the vial of "Brachyury, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.