IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using BRK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Rabbit anti-Human, Mouse BRK1 Polyclonal Antibody | anti-BRK1 antibody
BRK1 Rabbit pAb
Gene Names
NR1I3; CAR; CAR1; MB67
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry
Purity
Affinity purification
Synonyms
BRK1, Antibody; BRK1 Rabbit pAb; BRK1; C3orf10; HSPC300; MDS027; hHBrk1; anti-BRK1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Applicable Applications for anti-BRK1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human BRK1 (NP_060932.2).
Cellular Location
cytoskeleton, cytosol, extracellular exosome, SCAR complex
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using BRK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using BRK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human stomach using BRK1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human stomach using BRK1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human breast cancer using BRK1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human breast cancer using BRK1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-BRK1 antibody
Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity.
Product Categories/Family for anti-BRK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,942 Da
NCBI Official Full Name
nuclear receptor subfamily 1 group I member 3 isoform 11
NCBI Official Synonym Full Names
nuclear receptor subfamily 1, group I, member 3
NCBI Official Symbol
NR1I3
NCBI Official Synonym Symbols
CAR; CAR1; MB67
NCBI Protein Information
nuclear receptor subfamily 1 group I member 3; constitutive active receptor; constitutive active response; orphan nuclear receptor MB67; orphan nuclear hormone receptor; constitutive androstane receptor; constitutive activator of retinoid response; consti
UniProt Protein Name
Nuclear receptor subfamily 1 group I member 3
UniProt Gene Name
NR1I3
UniProt Synonym Gene Names
CAR; Constitutive active response; CAR
UniProt Entry Name
NR1I3_HUMAN
Similar Products
Product Notes
The BRK1 nr1i3 (Catalog #AAA282343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRK1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BRK1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BRK1 nr1i3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PVQLSKEQEE LIRTLLGAHT RHMGTMFEQF VQFRPPAHLF IHHQPLPTLA PVLPLVTHFA DINTFMVLQV IKFTKDLPVF RSLPIEDQIS LLKGAAVEIC HIVLNTTFCL QTQNFLCGPL RYTIEDGARV SPTVGFQVEF LELLFHFHGT LRKLQLQEPE YVLLAAMALF SPDRPGVTQR DEIDQLQEEM ALTLQSYIKG QQRRPRDRFL YAKLLGLLAE LRSINEAYGY QIQHIQGLSA MMPLLQEICS. It is sometimes possible for the material contained within the vial of "BRK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.