Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46404_IHC10.jpg IHC (Immunohistochemistry) (Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Human Mammary Cancer Tissue)

c-Rel Polyclonal Antibody | anti-c-Rel antibody

Anti-c-Rel Antibody

Gene Names
Rel; c-Rel
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
c-Rel, Antibody; Anti-c-Rel Antibody; Proto-oncogene c-Rel; Avian reticuloendotheliosis; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL; Oncogene REL avian reticuloendotheliosis; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog; V rel reticuloendotheliosis viral oncogene homolog (avian); v-rel avian reticuloendotheliosis viral oncogene homolog; anti-c-Rel antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
587
Applicable Applications for anti-c-Rel antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46404_IHC10.jpg IHC (Immunohistochemistry) (Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46404_IHC11.jpg IHC (Immunohistochemisry) (Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46404_IHC13.jpg IHC (Immunohiostchemistry) (Anti- c-Rel Picoband antibody, AAA46404,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- c-Rel Picoband antibody, AAA46404, Western blottingAll lanes: Anti c-Rel (AAA46404) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 69KDObserved bind size: 69KD)

product-image-AAA46404_WB15.jpg WB (Western Blot) (Anti- c-Rel Picoband antibody, AAA46404, Western blottingAll lanes: Anti c-Rel (AAA46404) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 69KDObserved bind size: 69KD)
Related Product Information for anti-c-Rel antibody
Description: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kappaB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.
References
1. Belguise, K., Sonenshein, G. E. PKC-theta promotes c-Rel-driven mammary tumorigenesis in mice and humans by repressing estrogen receptor-alpha synthesis. J. Clin. Invest. 117: 4009-4021, 2007. 2. Gilmore TD, Kalaitzidis D, Liang MC, Starczynowski DT (March 2004). "The c-Rel transcription factor and B-cell proliferation: a deal with the devil". Oncogene 23 (13): 2275-86. 3. Ruben SM, Klement JF, Coleman TA, Maher M, Chen CH, Rosen CA (Jun 1992). "I-Rel: a novel rel-related protein that inhibits NF-kappa B transcriptional activity". Genes Dev 6 (5): 745-60.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
64,960 Da
NCBI Official Full Name
Proto-oncogene c-Rel
NCBI Official Synonym Full Names
reticuloendotheliosis oncogene
NCBI Official Symbol
Rel
NCBI Official Synonym Symbols
c-Rel
NCBI Protein Information
proto-oncogene c-Rel
UniProt Protein Name
Proto-oncogene c-Rel
UniProt Gene Name
Rel
UniProt Entry Name
REL_MOUSE

Similar Products

Product Notes

The c-Rel rel (Catalog #AAA46404) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-c-Rel Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's c-Rel can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the c-Rel rel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "c-Rel, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.