Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198154_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: RelSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse REL Polyclonal Antibody | anti-REL antibody

REL Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
REL; C-Rel
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
REL, Antibody; REL Antibody - C-terminal region; anti-REL antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI
Sequence Length
587
Applicable Applications for anti-REL antibody
WB (Western Blot)
Homology
Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse REL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: RelSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA198154_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: RelSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: RELSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA198154_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: RELSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-REL antibody
This is a rabbit polyclonal antibody against Rel. It was validated on Western Blot

Target Description: This gene encodes a protein that belongs to the Rel homology domain/immunoglobulin-like fold, plexin, transcription factor (RHD/IPT) family. Members of this family regulate genes involved in apoptosis, inflammation, the immune response, and oncogenic processes. This proto-oncogene plays a role in the survival and proliferation of B lymphocytes. Mutation or amplification of this gene is associated with B-cell lymphomas, including Hodgkin's lymphoma. Single nucleotide polymorphisms in this gene are associated with susceptibility to ulcerative colitis and rheumatoid arthritis. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
proto-oncogene c-Rel isoform 2
NCBI Official Synonym Full Names
REL proto-oncogene, NF-kB subunit
NCBI Official Symbol
REL
NCBI Official Synonym Symbols
C-Rel
NCBI Protein Information
proto-oncogene c-Rel
UniProt Protein Name
Proto-oncogene c-Rel
UniProt Gene Name
REL
UniProt Entry Name
REL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The REL rel (Catalog #AAA198154) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REL Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's REL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the REL rel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSCVDNGLMN EPGLSDDANN PTFVQSSHYS VNTLQSEQLS DPFTYGFFKI. It is sometimes possible for the material contained within the vial of "REL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.