<
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using C1qa Rabbit pAb (AAA283210) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Rabbit anti-Mouse C1qa Polyclonal Antibody | anti-C1qa antibody
C1qa Rabbit pAb
Reactivity
Mouse
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
C1qa, Antibody; C1qa Rabbit pAb; C1q; Adic; C1qa; anti-C1qa antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Applicable Applications for anti-C1qa antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 23-245 of mouse C1qa (NP_031598.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using C1qa Rabbit pAb (AAA283210) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using C1qa Rabbit pAb (AAA283210) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using C1qa Rabbit pAb (AAA283210) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using C1qa Rabbit pAb (AAA283210) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using C1qa Rabbit pAb (AAA283210) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using C1qa Rabbit pAb (AAA283210) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using C1qa Rabbit pAb (AAA283210) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates / proteins: 25 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of various lysates using C1qa Rabbit pAb (AAA283210) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates / proteins: 25 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-C1qa antibody
Involved in several processes, including complement-mediated synapse pruning; microglial cell activation; and nervous system development. Acts upstream of or within complement activation, classical pathway. Located in postsynapse. Is expressed in brain; foot; genitourinary system; and pancreas. Used to study epilepsy and systemic lupus erythematosus. Human ortholog(s) of this gene implicated in glomerulonephritis. Orthologous to human C1QA (complement C1q A chain).
Product Categories/Family for anti-C1qa antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 26kDa
Observed MW: 30kDa/
Observed MW: 30kDa/
UniProt Protein Name
Complement C1q subcomponent subunit A
UniProt Gene Name
C1qa
UniProt Entry Name
C1QA_MOUSE
Similar Products
Product Notes
The C1qa c1qa (Catalog #AAA283210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1qa Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's C1qa can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the C1qa c1qa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EDVCRAPNGK DGAPGNPGRP GRPGLKGERG EPGAAGIRTG IRGFKGDPGE SGPPGKPGNV GLPGPSGPLG DSGPQGLKGV KGNPGNIRDQ PRPAFSAIRQ NPMTLGNVVI FDKVLTNQES PYQNHTGRFI CAVPGFYYFN FQVISKWDLC LFIKSSSGGQ PRDSLSFSNT NNKGLFQVLA GGTVLQLRRG DEVWIEKDPA KGRIYQGTEA DSIFSGFLIF PSA. It is sometimes possible for the material contained within the vial of "C1qa, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.