Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199420_WB13.jpg WB (Western Blot) (WB Suggested Anti-C1QB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Rabbit C1QB Polyclonal Antibody | anti-C1QB antibody

C1QB antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C1QB, Antibody; C1QB antibody - middle region; anti-C1QB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR
Sequence Length
253
Applicable Applications for anti-C1QB antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C1QB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C1QB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

product-image-AAA199420_WB13.jpg WB (Western Blot) (WB Suggested Anti-C1QB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

WB (Western Blot)

(Host: RabbitTarget Name: C1QBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199420_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: C1QBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-C1QB antibody
This is a rabbit polyclonal antibody against C1QB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-C1QB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
713
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
complement C1q subcomponent subunit B
NCBI Official Synonym Full Names
complement C1q B chain
NCBI Official Symbol
C1QB
NCBI Protein Information
complement C1q subcomponent subunit B
UniProt Protein Name
Complement C1q subcomponent subunit B
UniProt Gene Name
C1QB
UniProt Entry Name
C1QB_HUMAN

Similar Products

Product Notes

The C1QB c1qb (Catalog #AAA199420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1QB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the C1QB c1qb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGPKGESGDY KATQKIAFSA TRTINVPLRR DQTIRFDHVI TNMNNNYEPR. It is sometimes possible for the material contained within the vial of "C1QB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.