Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197668_WB11.jpg WB (Western Blot) (WB Suggested Anti-C4BPB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit C4BPB Polyclonal Antibody | anti-C4BPB antibody

C4BPB antibody - N-terminal region

Gene Names
C4BPB; C4BP
Reactivity
Dog, Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
C4BPB, Antibody; C4BPB antibody - N-terminal region; anti-C4BPB antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
Sequence Length
252
Applicable Applications for anti-C4BPB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 86%; Human: 100%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C4BPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C4BPB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA197668_WB11.jpg WB (Western Blot) (WB Suggested Anti-C4BPB Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: C4BPBSample Type: 721_BAntibody Dilution: 1.0ug/mlC4BPB is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA197668_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: C4BPBSample Type: 721_BAntibody Dilution: 1.0ug/mlC4BPB is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA197668_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-C4BPB antibody
This is a rabbit polyclonal antibody against C4BPB. It was validated on Western Blot and immunohistochemistry

Target Description: C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
725
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
C4b-binding protein beta chain isoform 1
NCBI Official Synonym Full Names
complement component 4 binding protein beta
NCBI Official Symbol
C4BPB
NCBI Official Synonym Symbols
C4BP
NCBI Protein Information
C4b-binding protein beta chain
UniProt Protein Name
C4b-binding protein beta chain
UniProt Gene Name
C4BPB
UniProt Entry Name
C4BPB_HUMAN

Similar Products

Product Notes

The C4BPB c4bpb (Catalog #AAA197668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C4BPB antibody - N-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's C4BPB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the C4BPB c4bpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CCLMVAWRVS ASDAEHCPEL PPVDNSIFVA KEVEGQILGT YVCIKGYHLV. It is sometimes possible for the material contained within the vial of "C4BPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.