Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281146_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human gastric cancer using CA9 antibody at dilution of 1:100 (40x lens).)

Rabbit CA9 Polyclonal Antibody | anti-CA9 antibody

CA9 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
CA9; MN; CAIX
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CA9, Antibody; CA9 Polyclonal Antibody; CAIX; MN; anti-CA9 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
Sequence Length
459
Applicable Applications for anti-CA9 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human CA9
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cell projection, Nucleus, Single-pass type I membrane protein, microvillus membrane, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using CA9 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281146_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human gastric cancer using CA9 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human stomach using CA9 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281146_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human stomach using CA9 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CA9 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.)

product-image-AAA281146_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CA9 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.)
Related Product Information for anti-CA9 antibody
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.
Product Categories/Family for anti-CA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
768
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 49kDa
Observed: 58kDa
NCBI Official Full Name
carbonic anhydrase 9
NCBI Official Synonym Full Names
carbonic anhydrase 9
NCBI Official Symbol
CA9
NCBI Official Synonym Symbols
MN; CAIX
NCBI Protein Information
carbonic anhydrase 9
UniProt Protein Name
Carbonic anhydrase 9
UniProt Gene Name
CA9
UniProt Synonym Gene Names
G250; MN; CA-IX; CAIX; RCC-associated antigen G250

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CA9 ca9 (Catalog #AAA281146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA9 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CA9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CA9 ca9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GSSGEDDPLG EEDLPSEEDS PREEDPPGEE DLPGEEDLPG EEDLPEVKPK SEEEGSLKLE DLPTVEAPGD PQEPQNNAHR DKEGDDQSHW RYGGDPPWPR. It is sometimes possible for the material contained within the vial of "CA9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.