Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199661_WB13.jpg WB (Western Blot) (WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Rabbit CAD Polyclonal Antibody | anti-CAD antibody

CAD antibody - N-terminal region

Gene Names
CAD; CDG1Z; GATD4; EIEE50
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAD, Antibody; CAD antibody - N-terminal region; anti-CAD antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
Sequence Length
2225
Applicable Applications for anti-CAD antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

product-image-AAA199661_WB13.jpg WB (Western Blot) (WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

WB (Western Blot)

(Lanes:1. 45ug capan1 cell lysate2. 45 ug HPAF cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:CADSubmitted by:Dr. Pankaj Singh, UNMC, Omaha, NE)

product-image-AAA199661_WB15.jpg WB (Western Blot) (Lanes:1. 45ug capan1 cell lysate2. 45 ug HPAF cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:CADSubmitted by:Dr. Pankaj Singh, UNMC, Omaha, NE)
Related Product Information for anti-CAD antibody
This is a rabbit polyclonal antibody against CAD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
790
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
243kDa
NCBI Official Full Name
CAD protein isoform 1
NCBI Official Synonym Full Names
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
NCBI Official Symbol
CAD
NCBI Official Synonym Symbols
CDG1Z; GATD4; EIEE50
NCBI Protein Information
CAD protein
UniProt Protein Name
CAD protein
UniProt Gene Name
CAD
UniProt Entry Name
PYR1_HUMAN

Similar Products

Product Notes

The CAD cad (Catalog #AAA199661) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAD antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CAD cad for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALVLEDGSV LRGQPFGAAV STAGEVVFQT GMVGYPEALT DPSYKAQILV. It is sometimes possible for the material contained within the vial of "CAD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.