Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281584_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug Calnexin antibody . Western blot was performed from the immunoprecipitate using Calnexin antibody at a dilition of 1:500.)

Rabbit Calnexin Polyclonal Antibody | anti-CANX antibody

Calnexin Rabbit pAb

Gene Names
CANX; CNX; P90; IP90
Reactivity
Human, Mouse, Rat
Applications
Immunoprecipitation, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Calnexin, Antibody; Calnexin Rabbit pAb; CNX; IP90; P90; Calnexin; CANX; calnexin; anti-CANX antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Applicable Applications for anti-CANX antibody
IP (Immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 501-592 of human Calnexin (NP_001737.1).
Cellular Location
Endoplasmic reticulum, Endoplasmic reticulum membrane, Melanosome, Single-pass type I membrane protein
Positive Samples
SW480, NIH/3T3
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug Calnexin antibody . Western blot was performed from the immunoprecipitate using Calnexin antibody at a dilition of 1:500.)

product-image-AAA281584_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug Calnexin antibody . Western blot was performed from the immunoprecipitate using Calnexin antibody at a dilition of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Calnexin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281584_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Calnexin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Calnexin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281584_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Calnexin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of SW480 cells, using Calnexin Rabbit pAb at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA281584_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of SW480 cells, using Calnexin Rabbit pAb at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-CANX antibody
Background: This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described.
Product Categories/Family for anti-CANX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
821
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,568 Da
NCBI Official Full Name
calnexin
NCBI Official Synonym Full Names
calnexin
NCBI Official Symbol
CANX
NCBI Official Synonym Symbols
CNX; P90; IP90
NCBI Protein Information
calnexin; major histocompatibility complex class I antigen-binding protein p88
UniProt Protein Name
Calnexin
UniProt Gene Name
CANX
UniProt Entry Name
CALX_HUMAN

Similar Products

Product Notes

The CANX canx (Catalog #AAA281584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Calnexin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Calnexin can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CANX canx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FCCSGKKQTS GMEYKKTDAP QPDVKEEEEE KEEEKDKGDE EEEGEEKLEE KQKSDAEEDG GTVSQEEEDR KPKAEEDEIL NRSPRNRKPR RE. It is sometimes possible for the material contained within the vial of "Calnexin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.