<
IF (Immunofluorescence)
(Immunofluorescence analysis of Mouse brain using CAMK2G antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit CAMK2G Polyclonal Antibody | anti-CAMK2G antibody
CAMK2G Rabbit pAb
Gene Names
BSG; M6; OK; 5F7; TCSF; CD147; EMMPRIN
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
CAMK2G; Polyclonal Antibody; CAMK2G Rabbit pAb; CAMK; CAMK-II; CAMKG; calcium/calmodulin dependent protein kinase II gamma; anti-CAMK2G antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL
Applicable Applications for anti-CAMK2G antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF/ICC: 1:50-1:200
IHC: 1:50-1:100
IF/ICC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CAMK2G (NP_751909.1).
Cellular Location
Cytoplasmic side, Peripheral membrane protein, Sarcoplasmic reticulum membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of Mouse brain using CAMK2G antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of Mouse brain using CAMK2G antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of Rat brain using CAMK2G antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of Rat brain using CAMK2G antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded mouse heart using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded mouse heart using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded rat heart using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded rat heart using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human stomach using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded human stomach using CAMK2G antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CAMK2G antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CAMK2G antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-CAMK2G antibody
The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.
Product Categories/Family for anti-CAMK2G antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,200 Da
NCBI Official Full Name
basigin isoform 1
NCBI Official Synonym Full Names
basigin (Ok blood group)
NCBI Official Symbol
BSG
NCBI Official Synonym Symbols
M6; OK; 5F7; TCSF; CD147; EMMPRIN
NCBI Protein Information
basigin; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor
UniProt Protein Name
Basigin
UniProt Gene Name
BSG
UniProt Synonym Gene Names
EMMPRIN; TCSF
UniProt Entry Name
BASI_HUMAN
Similar Products
Product Notes
The CAMK2G bsg (Catalog #AAA28433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK2G Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK2G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC). WB: 1:500-1:2000 IHC: 1:50-1:100 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the CAMK2G bsg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DSATEVTGHR WLKGGVVLKE DALPGQKTEF KVDSDDQWGE YSCVFLPEPM GTANIQLHGP PRVKAVKSSE HINEGETAML VCKSESVPPV TDWAWYKITD SEDKALMNGS ESRFFVSSSQ GRSELHIENL NMEADPGQYR CNGTSSKGSD QAIITL. It is sometimes possible for the material contained within the vial of "CAMK2G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
