Rabbit CAND1 Polyclonal Antibody | anti-CAND1 antibody
CAND1 antibody - middle region
Gene Names
CAND1; TIP120; TIP120A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAND1, Antibody; CAND1 antibody - middle region; anti-CAND1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS
Sequence Length
1230
Applicable Applications for anti-CAND1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAND1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CAND1 antibody
This is a rabbit polyclonal antibody against CAND1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.
Target Description: CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.
Product Categories/Family for anti-CAND1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
cullin-associated NEDD8-dissociated protein 1 isoform 1
NCBI Official Synonym Full Names
cullin associated and neddylation dissociated 1
NCBI Official Symbol
CAND1
NCBI Official Synonym Symbols
TIP120; TIP120A
NCBI Protein Information
cullin-associated NEDD8-dissociated protein 1
UniProt Protein Name
Cullin-associated NEDD8-dissociated protein 1
UniProt Gene Name
CAND1
UniProt Synonym Gene Names
KIAA0829; TIP120; TIP120A; TBP-interacting protein 120A
Similar Products
Product Notes
The CAND1 cand1 (Catalog #AAA197839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAND1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAND1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CAND1 cand1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALLTIPEAE KSPLMSEFQS QISSNPELAA IFESIQKDSS STNLESMDTS. It is sometimes possible for the material contained within the vial of "CAND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
