Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224251_IHC13.jpg IHC (Immunohiostchemistry) (Heart)

Rabbit Carboxypeptidase N1 Polyclonal Antibody | anti-CPN1 antibody

Carboxypeptidase N1 antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Carboxypeptidase N1, Antibody; Carboxypeptidase N1 antibody; Polyclonal Carboxypeptidase N1; Anti-Carboxypeptidase N1; Carboxypeptidase N Polypeptide 1; CPN1; FLJ40792; Carboxypeptidase N1; CPN; Carboxypeptidase N-1; Carboxypeptidase N 1; SCPN; anti-CPN1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Carboxypeptidase N1 antibody was raised against the middle region of CPN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPN1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
448
Applicable Applications for anti-CPN1 antibody
WB (Western Blot)
Biological Significance
Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Heart)

product-image-AAA224251_IHC13.jpg IHC (Immunohiostchemistry) (Heart)

WB (Western Blot)

(Recommended CPN1 Antibody Titration: 0.2-1 ug/ml)

product-image-AAA224251_WB15.jpg WB (Western Blot) (Recommended CPN1 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-CPN1 antibody
Rabbit polyclonal Carboxypeptidase N1 antibody raised against the middle region of CPN1
Product Categories/Family for anti-CPN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
50 kDa (MW of target protein)
NCBI Official Full Name
carboxypeptidase N1
UniProt Protein Name
Carboxypeptidase N1
UniProt Gene Name
CPN1
UniProt Entry Name
A0A0A7NUP8_OPLFA

Similar Products

Product Notes

The Carboxypeptidase N1 cpn1 (Catalog #AAA224251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Carboxypeptidase N1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Carboxypeptidase N1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Carboxypeptidase N1 cpn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Carboxypeptidase N1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.