Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201281_WB15.jpg WB (Western Blot) (WB Suggested Anti-CASQ1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Rabbit CASQ1 Polyclonal Antibody | anti-CASQ1 antibody

CASQ1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CASQ1; CASQ; PDIB1; VMCQA
Reactivity
Tested: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASQ1, Antibody; CASQ1 antibody - middle region; CASQ; PDIB1; VMCQA; anti-CASQ1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFAT
Sequence Length
390
Applicable Applications for anti-CASQ1 antibody
WB (Western Blot)
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Protein Size
390 amino acids
Blocking Peptide
For anti-CASQ1 (MBS3216385) antibody is Catalog
Preparation and Storage
For short term use, store at 2 to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CASQ1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

product-image-AAA201281_WB15.jpg WB (Western Blot) (WB Suggested Anti-CASQ1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-CASQ1 antibody
The protein encoded by this gene is a mitochondrial calcium-binding protein located in the luminal space of the terminal cisternae of the sarcoplasmic reticulum. The protein binds and putatively stores calcium ions. The protein is absent in patients with Duchenne and Becker types of muscular dystrophy.
Product Categories/Family for anti-CASQ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
844
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
calsequestrin-1
NCBI Official Synonym Full Names
calsequestrin 1
NCBI Official Symbol
CASQ1
NCBI Official Synonym Symbols
CASQ; PDIB1; VMCQA
NCBI Protein Information
calsequestrin-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CASQ1 (Catalog #AAA201281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASQ1 antibody - middle region reacts with Tested: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CASQ1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CASQ1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEGERELQAF ENIEDEIKLI GYFKSKDSEH YKAFEDAAEE FHPYIPFFAT. It is sometimes possible for the material contained within the vial of "CASQ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.