Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201699_WB11.jpg WB (Western Blot) (WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)

Rabbit CAV3 Polyclonal Antibody | anti-CAV3 antibody

CAV3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CAV3; LQT9; MPDT; RMD2; VIP21; LGMD1C; VIP-21
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CAV3, Antibody; CAV3 antibody - N-terminal region; anti-CAV3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
Sequence Length
151
Applicable Applications for anti-CAV3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Human: 100%; Mouse: 84%; Pig: 92%; Rat: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAV3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)

product-image-AAA201699_WB11.jpg WB (Western Blot) (WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)

WB (Western Blot)

(Lanes:Lane1: 50 ug human placental tissue lysateLane2: 40 ug human placental tissue lysateLane3: 30 ug human placental tissue lysateLane4: 20 ug human placental tissue lysateLane5: 20 ug human myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Caveolin 3Submitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)

product-image-AAA201699_WB13.jpg WB (Western Blot) (Lanes:Lane1: 50 ug human placental tissue lysateLane2: 40 ug human placental tissue lysateLane3: 30 ug human placental tissue lysateLane4: 20 ug human placental tissue lysateLane5: 20 ug human myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Caveolin 3Submitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)

IHC (Immunohistochemistry)

(Sample Type :Human placental tissue Primary Antibody Dilution :1:50Secondary Antibody :Goat anti rabbit-HRP Secondary Antibody Dilution :1:10,000Color/Signal Descriptions :Brown: CAV3Purple: HaemotoxylinGene Name :CAV3Submitted by :Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham)

product-image-AAA201699_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human placental tissue Primary Antibody Dilution :1:50Secondary Antibody :Goat anti rabbit-HRP Secondary Antibody Dilution :1:10,000Color/Signal Descriptions :Brown: CAV3Purple: HaemotoxylinGene Name :CAV3Submitted by :Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham)
Related Product Information for anti-CAV3 antibody
This is a rabbit polyclonal antibody against CAV3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CAV3 is a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
859
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
caveolin-3
NCBI Official Synonym Full Names
caveolin 3
NCBI Official Symbol
CAV3
NCBI Official Synonym Symbols
LQT9; MPDT; RMD2; VIP21; LGMD1C; VIP-21
NCBI Protein Information
caveolin-3
UniProt Protein Name
Caveolin-3
UniProt Gene Name
CAV3
UniProt Entry Name
CAV3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CAV3 cav3 (Catalog #AAA201699) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAV3 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAV3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CAV3 cav3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMAEEHTDLE AQIVKDIHCK EIDLVNRDPK NINEDIVKVD FEDVIAEPVG. It is sometimes possible for the material contained within the vial of "CAV3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.