Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197378_WB11.jpg WB (Western Blot) (WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/mlPositive Control: Human brain)

Rabbit CBX5 Polyclonal Antibody | anti-CBX5 antibody

CBX5 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CBX5; HP1; HP1A; HEL25
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
CBX5, Antibody; CBX5 antibody - middle region; anti-CBX5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE
Sequence Length
191
Applicable Applications for anti-CBX5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CBX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/mlPositive Control: Human brain)

product-image-AAA197378_WB11.jpg WB (Western Blot) (WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/mlPositive Control: Human brain)

WB (Western Blot)

(Sample Type: Human NT-2Sample Type: 1. Human NT-2 cells (60ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

product-image-AAA197378_WB13.jpg WB (Western Blot) (Sample Type: Human NT-2Sample Type: 1. Human NT-2 cells (60ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Sample Type :Human NT-2 cells Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :CBX5: Red DAPI:BlueGene Name :CBX5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA197378_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human NT-2 cells Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :CBX5: Red DAPI:BlueGene Name :CBX5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-CBX5 antibody
This is a rabbit polyclonal antibody against CBX5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
chromobox protein homolog 5
NCBI Official Synonym Full Names
chromobox 5
NCBI Official Symbol
CBX5
NCBI Official Synonym Symbols
HP1; HP1A; HEL25
NCBI Protein Information
chromobox protein homolog 5
UniProt Protein Name
Chromobox protein homolog 5
UniProt Gene Name
CBX5
UniProt Synonym Gene Names
HP1A; HP1 alpha
UniProt Entry Name
CBX5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CBX5 cbx5 (Catalog #AAA197378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBX5 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CBX5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CBX5 cbx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYKKMKEGEN NKPREKSESN KRKSNFSNSA DDIKSKKKRE QSNDIARGFE. It is sometimes possible for the material contained within the vial of "CBX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.