Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28620_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit anti-Human CCAR2/DBC1 Polyclonal Antibody | anti-CCAR2 antibody

CCAR2/DBC1 Rabbit pAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
CCAR2/DBC1, Antibody; CCAR2/DBC1 Rabbit pAb; CCAR2; DBC-1; DBC1; KIAA1967; NET35; p30 DBC; p30DBC; cell cycle and apoptosis regulator 2; CCAR2/DBC1; anti-CCAR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAY
Applicable Applications for anti-CCAR2 antibody
WB (Western Blot), IHC (Immunohistochemistry), ELISA
Application Notes
WB: 1:1000-1:5000
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CCAR2/DBC1 (NP_066997.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28620_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28620_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28620_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28620_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28620_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using CCAR2/DBC1 Rabbit pAb (AAA28620) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from 293F cells, using CCAR2/DBC1 Rabbit pAb (AAA28620) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28620_WB.jpg WB (Western Blot) (Western blot analysis of lysates from 293F cells, using CCAR2/DBC1 Rabbit pAb (AAA28620) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CCAR2 antibody
Enables RNA polymerase II complex binding activity and enzyme inhibitor activity. Involved in several processes, including regulation of cellular protein metabolic process; regulation of signal transduction; and regulation of transcription, DNA-templated. Located in several cellular components, including mitochondrial matrix; nucleoplasm; and spindle. Part of DBIRD complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 102kDa/103kDa
Observed MW: 130kDa
UniProt Protein Name
DBIRD complex subunit KIAA1967
UniProt Gene Name
KIAA1967
UniProt Synonym Gene Names
DBC1; DBC-1; DBC.1
UniProt Entry Name
K1967_HUMAN

Similar Products

Product Notes

The CCAR2 kiaa1967 (Catalog #AAA28620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCAR2/DBC1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCAR2/DBC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ELISA. WB: 1:1000-1:5000 IHC-P: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the CCAR2 kiaa1967 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQFKRQRIN PLPGGRNFSG TASTSLLGPP PGLLTPPVAT ELSQNARHLQ GGEKQRVFTG IVTSLHDYFG VVDEEVFFQL SVVKGRLPQL GEKVLVKAAY. It is sometimes possible for the material contained within the vial of "CCAR2/DBC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.