Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201195_WB13.jpg WB (Western Blot) (WB Suggested Anti-CCNB2 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellCCNB2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit CCNB2 Polyclonal Antibody | anti-CCNB2 antibody

CCNB2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CCNB2; HsT17299
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCNB2, Antibody; CCNB2 antibody - C-terminal region; anti-CCNB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKD
Sequence Length
398
Applicable Applications for anti-CCNB2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCNB2 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellCCNB2 is supported by BioGPS gene expression data to be expressed in NCIH226)

product-image-AAA201195_WB13.jpg WB (Western Blot) (WB Suggested Anti-CCNB2 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole CellCCNB2 is supported by BioGPS gene expression data to be expressed in NCIH226)

WB (Western Blot)

(Lanes:Lane1: 40 ug human HCT116 cell lysateLane2: 40 ug 1mM hydroxyurea treated HCT116 cell lysateLane3: 40 ug 10uM Etoposide treated human HCT116 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:CCNB2Submitted by:Claudia Schafer & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaCCNB2 is supported by BioGPS gene expression data to be expressed in HCT116)

product-image-AAA201195_WB15.jpg WB (Western Blot) (Lanes:Lane1: 40 ug human HCT116 cell lysateLane2: 40 ug 1mM hydroxyurea treated HCT116 cell lysateLane3: 40 ug 10uM Etoposide treated human HCT116 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:CCNB2Submitted by:Claudia Schafer & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaCCNB2 is supported by BioGPS gene expression data to be expressed in HCT116)
Related Product Information for anti-CCNB2 antibody
This is a rabbit polyclonal antibody against CCNB2. It was validated on Western Blot

Target Description: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
Product Categories/Family for anti-CCNB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
G2/mitotic-specific cyclin-B2
NCBI Official Synonym Full Names
cyclin B2
NCBI Official Symbol
CCNB2
NCBI Official Synonym Symbols
HsT17299
NCBI Protein Information
G2/mitotic-specific cyclin-B2
UniProt Protein Name
G2/mitotic-specific cyclin-B2
UniProt Gene Name
CCNB2
UniProt Entry Name
CCNB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCNB2 ccnb2 (Catalog #AAA201195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNB2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCNB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCNB2 ccnb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLEVMQHMAK NVVKVNENLT KFIAIKNKYA SSKLLKISMI PQLNSKAVKD. It is sometimes possible for the material contained within the vial of "CCNB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.